PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00653g06004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 182aa    MW: 21192 Da    PI: 10.3577
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00653g06004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF421.2e-131355547
                              SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                    SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                              n++ r + +  R ++++KKAeE S+LC++e+ v++fs + + y
  Peinf101Scf00653g06004.1 13 NERSRMIVLQERSATLFKKAEEFSILCGVEIGVVVFSVEENQY 55
                              88999999*****************************887666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-13160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.974161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-17183IPR002100Transcription factor, MADS-box
CDDcd001202.76E-16261No hitNo description
PRINTSPR004044.2E-9323IPR002100Transcription factor, MADS-box
PfamPF003195.9E-141352IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MARKKLKIAR LVNERSRMIV LQERSATLFK KAEEFSILCG VEIGVVVFSV EENQYESVWP  60
SKEKFKQILM KYLDKPLTER LKKLSTHEKY LRKEVDAGMN NLKTIAKKTE EKQMEQLFNQ  120
LYAGEKTILE LDKRQLIGVH NLAIKMKEKV VERRKQLNVQ DQRAQLPVDD PLALRLAPPG  180
SL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616634.16e-77PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_016502248.16e-77PREDICTED: agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31640.15e-17AGAMOUS-like 92